glp 1 peptide sequence GLP-1(1-37 or 1-36 - GLP 1rpeptide His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser Unraveling the GLP-1 Peptide Sequence: A Deep Dive into its Structure and Function

Glp 1副作用 The glp 1 peptide sequence is a critical element in understanding the biological roles of glucagon-like peptide-1 (GLP-1), a vital hormone with significant implications for metabolic health and therapeutic interventions. This article delves into the intricate amino acid sequence of GLP-1, exploring its structure, function, and the scientific journey of its discovery and application.

The Genesis of GLP-1: From Proglucagon to Bioactive Peptide

GLP-1 is not directly encoded but is derived from the post-translational processing of a larger precursor protein called proglucagon. This process, primarily occurring in the intestinal L cells, yields several biologically active peptides, including GLP-1 (1-37) and GLP-1 (7-37). The latter, GLP-1 (7-37), is particularly significant as it represents a truncated, bioactive form of the peptide. Early research, including work by C Orskov in 1989, was instrumental in isolating and sequencing GLP-1 from human small intestine, contributing to the foundational knowledge of its structure. The amino acid sequence of GLP-1 was first identified following the cloning of the cDNAs and genes encoding proglucagon in the early 1980s, marking a pivotal moment in endocrinology.

Deciphering the GLP-1 Peptide Sequence

The primary amino acid sequence of GLP-1 is a chain of amino acids that dictates its three-dimensional structure and, consequently, its biological activityGlucagon-Like Peptide (GLP) I (7-37). While the full-length GLP-1 (1-37) has a specific sequence, the most biologically relevant and commonly studied forms are truncated versionsThesequenceofGLP-1was first identified following the cloning of the cDNAs and genes encoding proglucagon in the early 1980s..

For instance, the GLP-1 (7-36) amide form, a widely recognized active peptide, possesses the following amino acid sequence: H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Arg-Gly-Arg-NH2. This sequence is identical in humans, rats, and mice, highlighting its conserved nature. Another representation of this sequence is HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2.

The GLP-1 (1-37) sequence is also documented, which includes additional amino acids at the N-terminusGlucagon-Like Peptide 1 Fragment 7-37 human. One reported sequence for Glucagon-like peptide 1 (1-37) (human, rat) is HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG.Protein. Glucagon-like peptide 1 receptor· Gene. GLP1R · Status. UniProtKB reviewed (Swiss-Prot) · Organism. Homo sapiens (Human) · Amino acids. 463 (go to ... The complete sequences of glucagon-like peptide-1 have been a subject of continuous scientific inquiry, with researchers meticulously detailing these chainsThe biologically active forms ofGLP-1are:GLP-1-(7-37) andGLP-1-(7-36)NH2.GLP-1secretion by L cells is dependent on the presence of nutrients in the lumen ....

Structural Features and Biological Significance

The GLP-1 peptide exhibits distinct structural features that contribute to its function.Ripples of Discovery Created a New Wave of Weight-loss ... Active GLP-1 protein secondary structure includes two α-helices from amino acid position 13–20 and 24–35, separated by a linker region. This helical structure is crucial for its interaction with its receptorGLP1R glucagon like peptide 1 receptor [ (human)]. The GLP-1 receptor (encoded by the GLP1R gene) plays a central role in mediating the hormone's effects. The Protein. Glucagon-like peptide 1 receptor is a G protein-coupled receptor that, upon binding GLP-1, triggers downstream signaling pathways.Glucagon-like Peptide-1 (GLP-1) (7-36)

GLP-1 is a potent incretin hormone, meaning it enhances glucose-dependent insulin release from pancreatic beta cells2天前—Researchers discovered that if theamino acid sequenceofGLP-1was modified to make it more degradation resistant, like exendin-4, the ability .... This glucose-dependent nature is a key safety feature, as it minimizes the risk of hypoglycemia. Furthermore, GLP-1 influences gastric emptying, satiety, and glucagon secretion, all of which contribute to blood glucose regulation. The amino acid sequence identical to that of human origin is a benchmark for evaluating the efficacy and safety of various therapeutic agentsSequence (1-letter):HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2Storage: -20 °C or below. Glucagon-like Peptide-1 (7-36) is one the two primary biologically active ....

Therapeutic Applications and the Evolution of GLP-1 Analogs

The understanding of the glp 1 peptide sequence has paved the way for the development of GLP-1 agonists, a class of drugs used to treat type 2 diabetes and, increasingly, obesity作者：Z Zheng·2024·被引用次数：710—GLP-1RAs are synthetic protein preparations thathave partial or complete amino acid sequence homology with GLP-1found in the body, are not .... These agonists are often synthetic analogs of GLP-1 designed to overcome the natural hormone's rapid degradation by the enzyme dipeptidyl peptidase-4 (DPP-4) and its short half-life.

Naturally occurring GLP-1 has a very short half-life, typically only a few minutes. To extend this, researchers have modified the peptide sequence. For example, the insertion of a 6-aminohexanoic acid between histidine and alanine at positions 7 and 8 of glucagon-like peptide 1 (GLP-1) has been shown to prevent N-terminal degradation. Synthetic analogs like exendin-4, originally discovered in the saliva of the Gila monster, exhibit a much longer circulation half-life (approximately 8 days) due to their resistance to DPP-4 degradation and their amino acid sequence homology with GLP-1. This has led to the development of long-acting GLP-1 receptor agonists like semaglutide and liraglutide, which are administered less frequently and offer sustained therapeutic benefits.

The development of these GLP-1 analogs represents a significant advancement in the treatment of metabolic disorders. Researchers continue to explore variations in the GLP-1 peptide sequence to create even more effective and targeted therapies.Glucagon-like peptide 1 (1-37) (human, rat) The journey from deciphering the initial GLP-1 peptide sequence to developing sophisticated therapeutic agents underscores the profound impact of molecular biology and peptide chemistry on modern medicineGlucagon-Like Peptide 1,(GLP-1), amide, human. The investigation into GLP-1 and its receptor continues to yield insights into glucose homeostasis and potential new avenues for managing conditions like obesity and diabetes.